SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005037 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005037
Domain Number 1 Region: 518-549,632-706
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000903
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005037   Gene: ENSOPRG00000005476   Transcript: ENSOPRT00000005485
Sequence length 752
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5412:976555:1001500:-1 gene:ENSOPRG00000005476 transcript:ENSOPRT00000005485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPIGNQYVVARPVYSSNGFAEEHKRKERRHKTVLDHLKLCCXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXGLVALQGLAFALLVNVPPAYGLYAAFFPAVVYFFLGT
SKHISVGPFPVLSMMVGAAVVRLAPDPGDTPDGSPNNQRNSQRRIMAAASVTFLAGIIQL
AFGILRIGIVVVYLSESLISAFTTAAALHVVVSQLKFMLQLTVPSYSDPFSIFKVLKSVF
TQIQKTNIADLVTSLIILVIVFIFKEINQRFKSKLPVPIPIELIVTVIAAGVSYGCDFEH
RFGVAVIGTMEKGFQTPTAPDIQIFQDAIGDGFSIAIVGFAVAFSVASVFSLKHDYAIDG
SQELIAFGLGNIVAGAFRGFAGSTALSRSAVQESTGGKTQIAGILSSVIVLIVILAIGFL
LQPLQKSVLAALALGNLKGMLMQFAEIGRLWKKDKYDCLIWIMTFIFAIVLRLGLGLAAS
VAFELLTIIFRTQFPKCTTLANIGRSNIYKNRKDYSDIYEPEGVKIFRCPAPIYFANIGF
FKHKLIEAIGFSPLRILRKRNKALKKIRKLQKQGHLQVTPKGFICTVDGIKDSDDEELDN
NQIEELDLPIDTTDLPFQIDWNADLPLNIVVPKISLHSLILDFSAVSFLDVSSMRGLKTI
LKEFSRIQVDVYIVGTDDEFIDKLAQCQFFDDEVKQSMFFLTIHDAILHIMMKKDYSASK
FNQEKEPKFDFTINTNGGLRNRDYQIPNETRF
Download sequence
Identical sequences ENSOPRP00000005037 ENSOPRP00000005037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]