SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005101 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005101
Domain Number 1 Region: 23-177
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.69e-54
Family G proteins 0.00000638
Further Details:      
 
Domain Number 2 Region: 305-363
Classification Level Classification E-value
Superfamily TGS-like 2.18e-24
Family G domain-linked domain 0.0002
Further Details:      
 
Domain Number 3 Region: 244-327
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000616
Family G proteins 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005101   Gene: ENSOPRG00000005569   Transcript: ENSOPRT00000005557
Sequence length 363
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2691:621361:793578:-1 gene:ENSOPRG00000005569 transcript:ENSOPRT00000005557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPN
ESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGI
FHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLK
PEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGF
AALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSEN
AVK
Download sequence
Identical sequences ENSOPRP00000005101 ENSOPRP00000005101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]