SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005142 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005142
Domain Number 1 Region: 377-626
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8e-62
Family Nuclear receptor ligand-binding domain 0.0000000025
Further Details:      
 
Domain Number 2 Region: 328-380
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000204
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005142   Gene: ENSOPRG00000005595   Transcript: ENSOPRT00000005601
Sequence length 632
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1676:14616:25628:1 gene:ENSOPRG00000005595 transcript:ENSOPRT00000005601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHQGQRPAPAPPWASGSCCPMSAPQTKAQSIQKDMPCIQAQYGTAAPSPGPRDHLAGDPL
TPEFSKPTMDLASPEAAPAAPTALPSFSTFMDGYAGEFDTFLYQLPPTAQPCSSASSSAS
STSSSSATSPASASFKFEDFHVYGCYPGALSGPLDETLSSSGSDYYGSPCSAPSPSTPSF
QPPQLSPWDSSFSHFSPSQTYDGLRAWTEQLPKASGSPQPAFFSFSPPAGSSPSPSLAQS
SLKLFPSSQATPQLREGDSYSMTGAFPGLAPTSPHLDSGMLDVSATSAKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQ
KCLAVGMVKEVVRTDSLKVRRGRLPSEPKPPDATPANLLTALVRAHLDSGPSTAKLDYSK
FQEPVLPRFGKEDAGDVQQFYDLLSASLEVIRKWAEKIPGFTELSPGDQDLLLESAFLEL
FSLRLSYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHGLAVDVPAFACL
SALVLTNERHGLQEPWRVEELQNRILSCLKEHLAAVSGEPQPASRLSRLLGKLPELRTMG
KQGLQRIFYLKLEDLVPPPPIVDKILMDMLPF
Download sequence
Identical sequences ENSOPRP00000005142 ENSOPRP00000005142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]