SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005145 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005145
Domain Number 1 Region: 5-230
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.11e-54
Family Rhodopsin-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005145   Gene: ENSOPRG00000005620   Transcript: ENSOPRT00000005604
Sequence length 232
Comment pep:novel scaffold:pika:scaffold_10351:26400:27118:-1 gene:ENSOPRG00000005620 transcript:ENSOPRT00000005604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFVMDENLTTVSEFILLGLTDDPVLQVILFMLFLSGNLSTIILIKISSQLHQPMYFLLSQ
LAFVDMGISSSVTPNMLVNFLRKRSTISYFGCVTQLGSGAFFGTSDASFLATMAYDRFVA
ICHPLLYSTKMSTQVCVQLLVMAYVVGFLNASTFIFSFFSLLFCGPNRVNHFFCDFAPLV
ELSCSDVSVPAAVPSFTAGPTIIITVFVIAVSYIYILITILKMRSTEGRKAF
Download sequence
Identical sequences ENSOPRP00000005145 ENSOPRP00000005145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]