SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005277 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005277
Domain Number 1 Region: 206-452
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 2.88e-47
Family ATP-dependent DNA ligase catalytic domain 0.00097
Further Details:      
 
Domain Number 2 Region: 459-604
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.05e-31
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00048
Further Details:      
 
Domain Number 3 Region: 624-748
Classification Level Classification E-value
Superfamily BRCT domain 7.2e-20
Family DNA topoisomerase II binding protein 1, TopBP1 0.048
Further Details:      
 
Domain Number 4 Region: 8-249
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 5.23e-17
Family ATP-dependent DNA ligase DNA-binding domain 0.0057
Further Details:      
 
Domain Number 5 Region: 803-911
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000465
Family BRCT domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005277   Gene: ENSOPRG00000005765   Transcript: ENSOPRT00000005748
Sequence length 911
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4191:17597:20332:-1 gene:ENSOPRG00000005765 transcript:ENSOPRT00000005748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASHTSQTVASHVPFADLCSTLERIQRSKGRAEKIRYFSEFLASWRKFHDALHKNQKDV
TDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPREGRDALKLLNYRAPTAAHG
DAGDFAMTAYFVLKPRCSQKGSLSVQQVNELLDSVASSNAARRKDLIKKSLLQLIVQSSA
LEQKWLIRMIVKDLKLGVSQQTILNAFHTDAVELHNVTTDLERVCRQLHDPSVGLTDISI
TLFSAFKPMLAAVADVERIEKDMKQQSFYIETKLDGERMQMHKDGDVYRYFSRNGYNYTE
QFGASPQEGSLSPFVHSAFRADAQVCILDGEMMAYSPHTQTFMQKGNKFDIKRMVEDSDL
QTCYCVFDVLMVNNKKLGRETLRNRYEILSSLFTPIPGRIEIVHKALAHTKNEVIDALNE
AIDKREEGIMIKHPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGLRGGMM
SHFLCAVAEKPPPGEKPSVFHTLCRVGSGYTMKELYDLGLKLNKCWKPFHRKAPPGSILC
GTEKPEVYIEPCNSVIVQVKAAEIVPSSMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLE
QLRGKALGKLATRHLCVGADDEPQEKKRKSAPKIKKVIGIIEHLKAPNLSNVNKVSSVFE
DVEFCVMSGTDSHPKPDLENRIAELGGCITQNPGPDTYCVIAGTENIRVKNIISSNKHDV
VKPAWLLECFRTKSCVPWQPRFMIHMCPSTKEHFAREYDRYGDSYFVDTDLNQLKEVFSG
MKNSHEQTPEEMASVIAELECRYSWDQSPLSLFRHHTVYLDLYTVINDLSTKIEGTRLAT
KALELRFHGARVVSCLAEGVSHVIIGEDRSRVPDFKAFRRTLKRKFKILQEGWVTDSVCK
SELQEENQYLL
Download sequence
Identical sequences ENSOPRP00000005277 ENSOPRP00000005277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]