SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005365 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005365
Domain Number 1 Region: 42-97
Classification Level Classification E-value
Superfamily Kringle-like 1.11e-16
Family Fibronectin type II module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005365   Gene: ENSOPRG00000005859   Transcript: ENSOPRT00000005843
Sequence length 97
Comment pep:novel scaffold:pika:scaffold_4994:112569:114985:1 gene:ENSOPRG00000005859 transcript:ENSOPRT00000005843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDIHYPEMVXXXXXXXXXXXXXXXXDCIQFNARHKCSLIQSYTGYWKYCTAADFAKCVFP
FWFRRMIYWECTDDGNDFGKKWCSLTQDFNRDQIWKF
Download sequence
Identical sequences ENSOPRP00000005365 ENSOPRP00000005365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]