SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005369 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005369
Domain Number 1 Region: 86-366
Classification Level Classification E-value
Superfamily C-type lectin-like 9.82e-94
Family Sulfatase-modifying factor-like 0.000000000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005369   Gene: ENSOPRG00000005850   Transcript: ENSOPRT00000005848
Sequence length 372
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2699:33710:137241:-1 gene:ENSOPRG00000005850 transcript:ENSOPRT00000005848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAVQPARGFSAGFGRRRGRVLLLPLLSLLCRAAGHEEVGAGAGSCGCGTPHRPGAQG
SAAAAHLYSREANAPGPVPGEQPPAPTKMVLIPAGVFTMGTDDPKIKQDGEAPARRVAVD
AFYMDAYEVSNADFEKFVNSTGYLTEAERFGDSFVFEGMLSERVKTDIHQAXXXXXXXXX
XXXXXXXXXXXXXXXXXXXPHHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLQNR
LFPWGNKLQPRGQHYANLWQGDFPVTDTGEDGFRGTAPVDAFPPNGYGLYNMVGNAWEWT
SDWWTRYHSVEEAQNPKGPPSGKDRVKKGGSYMCHKSYCYRYRCAARSQNTPDSSASNLG
FRCAADRLPSTD
Download sequence
Identical sequences ENSOPRP00000005369 ENSOPRP00000005369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]