SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005413 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005413
Domain Number 1 Region: 529-560,636-709
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000628
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005413   Gene: ENSOPRG00000005892   Transcript: ENSOPRT00000005894
Sequence length 745
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3556:116655:157134:-1 gene:ENSOPRG00000005892 transcript:ENSOPRT00000005894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEEQAPLAAPERYRVERPIFSHPVLQERLHTKDKVADSIGDKLKQAFTFTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXPFAVISLMIGGVAVRLVPDDIVIPGGVNSTNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNIKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKMPAPIPLEFFAVVMG
TGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAVVGFSVTISMAKT
LANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFADLPFFWRTSKIELTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPETDVYIDIDAFEEIKEIPGIKIFQI
NAPIYYANSDLYSNALKRKTGVDPAVIMGARRKAMRKYAKEVGNVNMASAIMVKPAQDAE
VDGESAKPEDDDGEVKFPPIVVRGAFPEELQRFMPPREHIHTIILDFTQVNFIDSVGVKT
LAGIVKEYGDVGIYVYLAGCSAQVVTDLTQNRFFENPALKELLFYSIHDAVLSSQVREAL
AAQEALAAPPQEDMEPKATASTPEA
Download sequence
Identical sequences ENSOPRP00000005413 ENSOPRP00000005413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]