SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005534 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005534
Domain Number 1 Region: 32-353
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.18e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000823
Further Details:      
 
Domain Number 2 Region: 348-452
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.01e-17
Family Ricin B-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005534   Gene: ENSOPRG00000006029   Transcript: ENSOPRT00000006026
Sequence length 453
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3648:179234:212645:1 gene:ENSOPRG00000006029 transcript:ENSOPRT00000006026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLQLQGEELRLQEESVRKHQINIYLSDRISLHRRLPERWNPLCKEVKYDYDHLPKTSVII
AFYNEAWSTLLRTVYSVLETSPDVLLEEVILVDDYSDREHLKERLANELSGLPKVRLIRA
TKREGLVRARLLGASAAKGDVLTFLDCHCECHEGWLEPLLQRIHEKESAVVCPVIDVIDW
NTFEYLGNPGEPQIGGFDWRLVFTWHVVPERERLRMRSPIDVIRSPTMAGGLFAVSKKYF
EYLGSYDTGMEVWGGENLEFSFRIWQCGGTLETHPCSHVGHVFPKQAPYSRSKALANSVR
AAEVWMDEFKEIYYHRNPRARLEPFGDVTERKQLREKLQCKDFKWFLETVYPELHVPEDR
PGFFGMLQNKGLKDYCFDYNPPDENQITGHQVILYMCHGMGQNQFFEYTSQKEIRYNTHQ
PEGCVAVEVGKDILVMHPCQDTTPENQKFLLQE
Download sequence
Identical sequences ENSOPRP00000005534 ENSOPRP00000005534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]