SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005613 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000005613
Domain Number - Region: 3-60
Classification Level Classification E-value
Superfamily Tropomyosin 0.0294
Family Tropomyosin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005613   Gene: ENSOPRG00000006119   Transcript: ENSOPRT00000006117
Sequence length 140
Comment pep:known_by_projection scaffold:pika:scaffold_22776:3916:10552:1 gene:ENSOPRG00000006119 transcript:ENSOPRT00000006117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRALQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKART
AQLAKIKWVISVAFYILQAALMISLIWKYYSVPVAVVPRKWITPLDRLVAFPTRVAGGVG
VTCWILVCNKVVAIVLHPFS
Download sequence
Identical sequences ENSOPRP00000005613 ENSOPRP00000005613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]