SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005623 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005623
Domain Number 1 Region: 544-576,713-787
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000581
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005623   Gene: ENSOPRG00000006117   Transcript: ENSOPRT00000006127
Sequence length 964
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1231:5491:130283:-1 gene:ENSOPRG00000006117 transcript:ENSOPRT00000006127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMIPERSSQSFNYKYSQNFTYDVKRDIYNEENFQQEHRRKGFSSGNMDIDITTFRHHIQC
RCSWHRFLRCMLTVFPFLEWMCLYRFKDWLLGDLLAGMSVGLVQVPQGLTFTLLARQLIP
PLNIAYSGFCSSVIYVILGSCHQMSIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXLCMGVLGFGFVATYVPEATISAYLAATAMHMML
SQLTCIFGIMISFHAGPISFFYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXILGFSVIANQISMATENSKMLVEMIPYSFLFPITPDVSELRRVFFQAI
SLALVSSFMLMFLGRKIASLHNYKVNSNQXXXXXXXXXXXXXFFRSFVFTGSIARTIIQD
KCGGRQQFASLVGAGLMLLLMVKAGHFFCELPNAVLAGIILSNVLPYLETIYNLPTLWRQ
DQYDFILWMVTFSSTIFLGLDLGLLVSLAFTFFIITVRSHRIKILLLGQIPNTNIYRSAN
EYREILCIPGVKIFQCCNSITFVNVDHLKHKLLKELDLVRVPLKEEEIFSLFKSSDTELQ
ENKICRCACDCDELESPPRIAYTEQFESKQESSASSINLVRCSRLYSMNSQDSYEDQEPR
TMSSISQRNPSRNYENVDKGWPSNYSQRNNSLPLANQSQGRSRSSIPFSDSFLEPITHTI
ILDFTMVHFVDAQXXXXXXXMCNAFQNADILVLIAGCHTSVVRAFEKNEFFDSGITKSQL
FLSVHDAALFAMSRKFLEPSELSLDESETVIQETYSETEKQDKPGSKTSDRFLAGTTNPS
LGFSKIVEPIEEELSESDMELQPVMQADKGTRVGLDLDLDQELEPESDVEPKTESEIQPE
PEPEPHEAEPARAPMPVSRTRIYSLPARLYHPMYHESKSQSQNQPSTEKRHQQTTSYTSQ
DHNK
Download sequence
Identical sequences ENSOPRP00000005623 ENSOPRP00000005623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]