SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005644 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005644
Domain Number 1 Region: 32-183
Classification Level Classification E-value
Superfamily C-type lectin-like 8.27e-20
Family C-type lectin domain 0.0035
Further Details:      
 
Domain Number 2 Region: 383-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000201
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 3 Region: 419-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000101
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 4 Region: 256-375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000122
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005644   Gene: ENSOPRG00000006161   Transcript: ENSOPRT00000006152
Sequence length 647
Comment pep:known_by_projection scaffold:pika:scaffold_165:546553:548724:-1 gene:ENSOPRG00000006161 transcript:ENSOPRT00000006152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSLGPLLLLLLLLSGQPWVGAGAHMEAVVCAGTACYTAHWSKLSAAEAQENCNSNGGN
LATVKSEEEAQIIQQALAQLLRSEVSPAMRTRKFWIGLQREKGKCSDSNLPLKGFSWVGG
GEDTLYTNWHKELKSSCISKRCVSLMLDPSMPPLASRLPKWSESPCGSSGSPGSNIEGFV
CKFNFQGMCQPLALGGPGQVSYITPFQATSSTLEAVPFGSMAKVVCGNRTESHGDYLLCK
EKGLQVFEWDKPGPLCVSPEYGCGFNNGGCHQECFEGGDGSFRCGCRPGFRLLDDLVTCA
SRNPCSSNPCTGEEATCVPEPHGKSYVCHCPHGYRQDSSQRGCVDVDECQDSPCAQECVN
TPGGYRCDCWVGYEPGGPGQEACLDVDECASGRSPCAQGCTNTDGSFHCSCEEGYLVGED
GTQCQDVDECASPRGSPCDGLCFNTPGSFHCGCLPGRELAPDGVSCIMVPVSPGPSSEPP
QQETEPGREGSTVSPAPMSNATRGPEGTSQAAPKARSPLLLLNHSTTWAASGGLPGVQLE
PGIQHTTVAAGHDTSIGADSVATQSVDGGAEGQKLLLFYILGTVVAIALLLALALGLLVY
RKRRARKEEMKEKKKPQSAADGYSWVPERAESRATENPYSPTPGTDC
Download sequence
Identical sequences ENSOPRP00000005644 ENSOPRP00000005644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]