SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005718 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005718
Domain Number 1 Region: 189-304
Classification Level Classification E-value
Superfamily EF-hand 1.77e-40
Family Osteonectin 0.00000089
Further Details:      
 
Domain Number 2 Region: 97-152
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000194
Family Ovomucoid domain III-like 0.0000385
Further Details:      
 
Domain Number 3 Region: 72-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000129
Family Follistatin (FS) module N-terminal domain, FS-N 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005718   Gene: ENSOPRG00000006237   Transcript: ENSOPRT00000006235
Sequence length 306
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5200:436711:445637:-1 gene:ENSOPRG00000006237 transcript:ENSOPRT00000006235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAWIFFLVCLAGRALAAPQQEALPDETEVVSETMVEVAEVAEVPVGANPVQVEVGEFEE
VEETEEEVVVENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPVGDFEKVCSNDNKT
FDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPXXXXXXXXXXXXXXXVRRRGVLAL
DTRSDVANILLTEKQKLRVKKIHENEKRLEAGNHPVELLARDFEKNYNMYIFPVHWQFGQ
LDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEKDI
DKELVI
Download sequence
Identical sequences ENSOPRP00000005718 ENSOPRP00000005718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]