SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005855 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005855
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 7.72e-56
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005855   Gene: ENSOPRG00000006394   Transcript: ENSOPRT00000006387
Sequence length 195
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1943:3642:10725:1 gene:ENSOPRG00000006394 transcript:ENSOPRT00000006387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGPFGEHTVNASWMAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVH
VGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSVIDMDAVCKRLTTL
GLDVSVTISQDAGRYLCDFTYYTSLYQGHGRSAFVHVPPLGKPYNADQLGRALRVIIEEM
LGVLEQSDDKAGCYH
Download sequence
Identical sequences ENSOPRP00000005855 ENSOPRP00000005855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]