SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005890 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005890
Domain Number 1 Region: 114-404
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.15e-58
Family Nuclear receptor ligand-binding domain 0.0000381
Further Details:      
 
Domain Number 2 Region: 45-129
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-28
Family Nuclear receptor 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005890   Gene: ENSOPRG00000006427   Transcript: ENSOPRT00000006425
Sequence length 404
Comment pep:known_by_projection scaffold:pika:scaffold_31001:5707:9928:1 gene:ENSOPRG00000006427 transcript:ENSOPRT00000006425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQGRPAALTSSTMAAAAPAAVAASRKESPGRWGLGEDPTGTGPSLQCRVCGDSSSGKHYG
TYACNGCSGFFKRSVRRRLIYRCQVGTGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQN
ERQPRSTAQVRLDSMDADSKPQGPEALASPPGPMGPSPRSQPPVSAARALGHHFMASLIT
AETYAKLEPEDADGNIAVNSNDPEVSASPCGLDGVHETSARLLFMAVKWAKNLPAFSNLP
FRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLPPPEASAIAGGSQGRLVLAGVEMRTLQ
ETIARFRALAVPEFACLKALVLFRPETRGLKDPEHVEALQDQSQAMLSQHSKAHHPSQPV
RFGKLLLLLPSLRFIPSERVELLFFRKTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences ENSOPRP00000005890 ENSOPRP00000005890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]