SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005891 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005891
Domain Number 1 Region: 44-131,176-201
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000018
Family Single strand DNA-binding domain, SSB 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005891   Gene: ENSOPRG00000006424   Transcript: ENSOPRT00000006426
Sequence length 848
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2822:3436:20718:1 gene:ENSOPRG00000006424 transcript:ENSOPRT00000006426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEESDEPQAGPSSAGLDWPNLERNRAGVPGGVIRRASGQGCMSWIQKVLEQIVDSPLTW
VTPKEVAFVSVLAVQRYLLEEPDDNVRGGPLYCYDVTISDGVYREKCYLDPSLNSLVYKN
ILKVGIEMKISRVSCLYNEKRLGQGILCIDNVQCGRTLDAISLETPFRNRAQGVKPERPL
RGGKSHYLALWNNEDPYGDIWLTDKQPKEHNFTXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNDQPYTNDIK
VQNFIQWVTRKTESGQVENTVIGGYYPYPPVPETFSKYSNFIKAHSFLTPVSEVKKEIEV
LQYREQKRIAIQGIITVIKYIPHSSAVKSASASETLWNANRSSASPAARAESQEGNRKCY
YDRPVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWK
SLGKMPKTFTDRWESQMWRDKKYHVTDHLHYSQVYPESIPRKFLFEHRNFLTQQYNSQPS
KYIPPAERPPKLEDFKSARSLGHFEITILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXDIDQCSDPEALAGDIIKAVTELDRVHIVGILDFCNLGNNKVEIYLQK
IYTPEDTS
Download sequence
Identical sequences ENSOPRP00000005891 ENSOPRP00000005891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]