SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005962 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005962
Domain Number 1 Region: 100-136
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000000275
Family Hormone receptor domain 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000005962
Domain Number - Region: 109-388
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000137
Family Rhodopsin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005962   Gene: ENSOPRG00000006511   Transcript: ENSOPRT00000006509
Sequence length 434
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1030:2491:54398:-1 gene:ENSOPRG00000006511 transcript:ENSOPRT00000006509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDPTAPPGLLLFLLCLLPPPLLQASGLSQGPRDQSLRTLLEQYCHGPRPPVLTQLPXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNAYRECLENGTWASRINYSQ
CEPILDDKQRKYDLHYRIALVVNYLGHCISMAALVAAFLLFLALRSIRCLRNVIHWNLIA
TFILRNVTWFLLQLIDHEVHETNEVWCRCITTIFNYFVVTNFFWMFAEGCYLHTAIVMTY
STERLRKWLFLFIGWCVPCPIIIAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLL
INFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQ
IVFIYFNSFLQSFQGFFVSVFYCFFNGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSP
TRISFHSIKHTAAV
Download sequence
Identical sequences ENSOPRP00000005962 ENSOPRP00000005962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]