SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006002 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006002
Domain Number 1 Region: 145-450
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000211
Family Rhodopsin-like 0.021
Further Details:      
 
Domain Number 2 Region: 112-161
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00000000667
Family Hormone receptor domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006002   Gene: ENSOPRG00000006552   Transcript: ENSOPRT00000006554
Sequence length 496
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1030:294021:326016:1 gene:ENSOPRG00000006552 transcript:ENSOPRT00000006554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGILWVSLAAFLLLPMATAMHSDCIFKKEQAMCLEKIQRANDLLGLNDSSPXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXWETETIGELGFAESNSLDLADMGVVSRNCTE
DGWSEPFPHYFDACGFDEYESEPGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRK
LHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSNHCFVSTVECKAVMVFFHYCVVSN
YFWLFIEGLYLFTLLVETFFPERRYFYWYIIIGWGTPTVCVTVWATLRLYLDDTGCWDMN
DSTALWWVIKGPVVGSIMVNFVLFIGIIIILVQKLQSPDMGGNESSIYFSCVQKCYCKPQ
RAEQHPCKMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQ
GFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFTVDFKHRHPSLASSGMNGGTQLSILSKS
SSQLRMSSLPADNLAT
Download sequence
Identical sequences ENSOPRP00000006002 ENSOPRP00000006002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]