SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006083 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006083
Domain Number 1 Region: 101-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000107
Family EGF-type module 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006083   Gene: ENSOPRG00000006641   Transcript: ENSOPRT00000006640
Sequence length 205
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2767:625273:635460:-1 gene:ENSOPRG00000006641 transcript:ENSOPRT00000006640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLPSAVLKLFLAAVLSSLVTGDSLERLRRGLAAATSNPDPTGATDQLLSTGGARAREV
LDLENTDLYRAAFSSQPQALATPSKEERGKKKKKGKGLGKKRDPCLKKYKDFCIHGECKY
LKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLM
FRYHRRGGYDVENEEKVKLGMTNSH
Download sequence
Identical sequences ENSOPRP00000006083 ENSOPRP00000006083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]