SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006306 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006306
Domain Number 1 Region: 115-362
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.46e-68
Family Nuclear receptor ligand-binding domain 0.00000000146
Further Details:      
 
Domain Number 2 Region: 48-129
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000377
Family Nuclear receptor 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006306   Gene: ENSOPRG00000006889   Transcript: ENSOPRT00000006884
Sequence length 445
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3617:42665:64144:1 gene:ENSOPRG00000006889 transcript:ENSOPRT00000006884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMANYSEVLDPTYTTLEFETMQILYNSNDSSAPETTSMNSTDNGVNCLCAICGDRATGK
HYGASSCDGCKGFFRRSIRKSHVYSCXXXXXXXXXXXXXXXXXXXRLRCFRAGMKKEAVQ
NERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISASSPGASTDINVKKIASIGDVCESM
KQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMYKDILLLGNNYVI
HRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVQIKNMR
FQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQE
MLLGGASNDGNHLHHPMHPHLSQDPLTGQTILLGPMSTLVHTDQISTPETPLPSPPQGSA
QEQYKLAANQASVISHQPLSKQKQL
Download sequence
Identical sequences ENSOPRP00000006306 ENSOPRP00000006306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]