SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006641 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006641
Domain Number 1 Region: 45-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000029
Family EGF-type module 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006641   Gene: ENSOPRG00000007254   Transcript: ENSOPRT00000007251
Sequence length 132
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3518:96996:101111:1 gene:ENSOPRG00000007254 transcript:ENSOPRT00000007251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGVPIPVYLLFNAIGAFAEANVTTSPGPVRKTDYIEGPMALKFSRPCLEDHNSYCING
VCLFHPELEKIICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLISGFLAVFYC
YVRKRYEKNKIC
Download sequence
Identical sequences ENSOPRP00000006641 ENSOPRP00000006641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]