SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006649 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006649
Domain Number 1 Region: 66-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000312
Family EGF-type module 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006649   Gene: ENSOPRG00000007265   Transcript: ENSOPRT00000007261
Sequence length 169
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3518:155634:171374:1 gene:ENSOPRG00000007265 transcript:ENSOPRT00000007261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAAGTGMETRRAGRAAALLLSFGFHLLQAVVGTTVIPSCIPGEAEDNCTALVQKEDNPR
VAQVSITKCGSDMNGYCLHGQCIYLVDMSENYCRCEVGYTGVRCEHFFLTVHQPLSKEYV
VTVILIILFLVIVAGSIYYFCRWYKHRQSKESKKEYERVTSRDPGLLQV
Download sequence
Identical sequences ENSOPRP00000006649 ENSOPRP00000006649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]