SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006658 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006658
Domain Number 1 Region: 142-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000106
Family EGF-type module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006658   Gene: ENSOPRG00000007273   Transcript: ENSOPRT00000007270
Sequence length 253
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3518:237079:269877:1 gene:ENSOPRG00000007273 transcript:ENSOPRT00000007270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPPQPLVAQVLLSLLILGSGPCSTGLELNDTSSGRGELFSGDHSADGLEVTSRTELSS
GSEVSSVSEVPAAGDLSSGADEDYPEDYDNEPRVSGYVVDGTVRVEQVIKPKNKAESEKT
SDKPKKKKKGGKNGKDRKNKKKKNPCEAEYKTFCIHGECKYIEHLKTVTCKCQHDYFGER
CGEKSMKTQSIVDSDLSKIAVAAIIAFVSAVSFTAVAVIITVQLRKRYIREYEGEAEERK
TLRQENGNAHAIA
Download sequence
Identical sequences ENSOPRP00000006658 ENSOPRP00000006658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]