SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006672 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006672
Domain Number 1 Region: 48-259
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.44e-59
Family Proteasome subunits 0.00000000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006672   Gene: ENSOPRG00000007283   Transcript: ENSOPRT00000007284
Sequence length 264
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2638:129564:131974:1 gene:ENSOPRG00000007283 transcript:ENSOPRT00000007284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALSESRAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPMRTGTSVLGVK
FEGGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLKQVLGQMVIDEE
LLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYAGGESFLGYVDMLGVAYEAP
SLATGYGAYLAQPLLREVLEKQPILSQAEARELVERCMRVLYYRDARSYNRFQIATVTEK
GVEIEGPLSAETNWDIAHMISGFE
Download sequence
Identical sequences ENSOPRP00000006672 ENSOPRP00000006672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]