SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Ochotona princeps 76 > ENSOPRP00000006689

Domain assignment for ENSOPRP00000006689 from Ochotona princeps 76

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSOPRP00000006689
Domain Number 1	Region: 15-59
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.000000000464
Family	EGF-type module	0.011
Further Details:

Domain Number 2	Region: 95-134
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000000897
Family	EGF-type module	0.0052
Further Details:

Domain Number 3	Region: 55-102
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000143
Family	EGF-type module	0.019
Further Details:

Domain Number 4	Region: 127-149
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000917
Family	EGF-type module	0.018
Further Details:

Weak hits

Sequence:	ENSOPRP00000006689
Domain Number -	Region: 1-19
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0118
Family	EGF-type module	0.034
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSOPRP00000006689 Gene: ENSOPRG00000007308 Transcript: ENSOPRT00000007303
Sequence length	150
Comment	pep:novel genescaffold:pika:GeneScaffold_1497:7296:48700:-1 gene:ENSOPRG00000007308 transcript:ENSOPRT00000007303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	CDCTSGWTGKNCSEEINECDSDPCMNGGLCHESAIPGQFICLCPPFYMGSFCHQHYSPCD LLNDPCRNNSTCLTLLDGNHYCICKEGFVGDYCETDVNECLSHPCLNEGHCEDGVSDFRP GFSGHLCEIEINECSSRPCKNNGTCVDLEN
Download sequence
Identical sequences	ENSOPRP00000006689 ENSOPRP00000006689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]