SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006711 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006711
Domain Number 1 Region: 270-367
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.49e-34
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.00000113
Further Details:      
 
Domain Number 2 Region: 515-614
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.61e-25
Family ETF-QO domain-like 0.00000276
Further Details:      
 
Domain Number 3 Region: 229-269,367-513
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.2e-21
Family FAD-linked reductases, N-terminal domain 0.0000000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006711   Gene: ENSOPRG00000007325   Transcript: ENSOPRT00000007327
Sequence length 616
Comment pep:novel genescaffold:pika:GeneScaffold_5167:7220:35954:1 gene:ENSOPRG00000007325 transcript:ENSOPRT00000007327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAPLARLSCPASLCLHAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATFERGLELHAR
VTVFAEGCHGHLAKQLYKKFDLRANCQPQTYGIGLKELWIIDEKNWKPGRVDHTVGWPLD
RHTYGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGRRIAY
GARALNEGGLQSIPKLTFPGGLLIGCSPGFMNVPKIKGSHTAMKSGILAAESIFNQLNTE
NLQSKTIGLHVTEYEENLKKSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWIFRGM
EPWTLKHKGSDSEKLRPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHDHDQPAHLTLQD
DSIPVSRNLAVYDGPEQRFCPAXXYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQNI
NWVVPEGGGGPAYNGM
Download sequence
Identical sequences ENSOPRP00000006711 ENSOPRP00000006711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]