SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006725 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006725
Domain Number 1 Region: 21-196
Classification Level Classification E-value
Superfamily Lysozyme-like 3.56e-21
Family G-type lysozyme 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006725   Gene: ENSOPRG00000007347   Transcript: ENSOPRT00000007341
Sequence length 196
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2681:98192:106545:-1 gene:ENSOPRG00000007347 transcript:ENSOPRT00000007341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLWLLLGLLTLTASSESNWGCYGNIRTLDTPGASCGIGRRYGLPYCGVRASERLAEID
MPRLLRYQPMMRTVGQRYCVDPAVIAGVLSRESQGSNVLVHVGSTDDGIRAAQGPALYAP
TSWIREPQVSQLTEVLTARIKEIQRRFPTWTPDQHLRGGLCAYNGGPAYVRSTQDLSCEF
CNDVLARAKYLKRHGF
Download sequence
Identical sequences ENSOPRP00000006725 ENSOPRP00000006725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]