SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006795 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006795
Domain Number 1 Region: 139-456
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.29e-122
Family Transglutaminase core 0.0000000000831
Further Details:      
 
Domain Number 2 Region: 4-136
Classification Level Classification E-value
Superfamily E set domains 2.83e-38
Family Transglutaminase N-terminal domain 0.00000614
Further Details:      
 
Domain Number 3 Region: 480-590
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.63e-29
Family Transglutaminase, two C-terminal domains 0.00000332
Further Details:      
 
Domain Number 4 Region: 591-689
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.96e-26
Family Transglutaminase, two C-terminal domains 0.00000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006795   Gene: ENSOPRG00000007417   Transcript: ENSOPRT00000007419
Sequence length 690
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5005:487744:515987:1 gene:ENSOPRG00000007417 transcript:ENSOPRT00000007419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEPQNINWQIGINRQAHHTDKFSSRDLILRRVQPLISLSFNRRLGSGDNLEFTVSTGPYP
SESTGTKAVFPLSSETSRGGWNAVLKGSNNNILTVTISTPANAPIGLYTLSTQISSQGRV
STVTLGTFILLFNPWLQADDVFLSNHAERQEYVEEDSGVIYVGSTNRIGMVGWNFGQFEE
DILNICLSILNQSLNFRRDPATDVALRKDPRYVGRVLSAMINSNDDNGVVAGNWSGNYPN
GRDPRNWNGSVEILKEWKKSGFRPVQYGQCWVFAGVLNTVLRCLGIPSRVITNFNSAHDT
NRNLSVDVYYDPMGNPLDRGSDSVWNFHVWNEGWFVRNDLGSSYNGWQVLDATPQERSQG
VFQCGPSSVHAIRNGDVDLDFDTPFVFAEVNADRITWIYDNSTSSQKQNSLDTRSVGKYI
STKAVGSYSRVDVTDKYKYPEGSSEERSVFQKALGKLKPRASFNPTSARDVVEEERVVSI
SGRFKITGVLAVGKEVSLALLLKNRSSEKKTVSVNMTAWTIVYNGTLVHEVWKDSFTVTL
DPEEETQHPVIISYAQYDRYLKSDNMIRATAICKVPEEAEVVVARDVILDNPTLTLEVLD
QAQVQKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGNLKIEVPTLRPKERSRVRFEILP
TRSGTKQLLADFSCNKFPAIKAMLSIDVAE
Download sequence
Identical sequences ENSOPRP00000006795 ENSOPRP00000006795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]