SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006799 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006799
Domain Number 1 Region: 224-537
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.38e-83
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000101
Further Details:      
 
Domain Number 2 Region: 92-211
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-24
Family Anticodon-binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006799   Gene: ENSOPRG00000007419   Transcript: ENSOPRT00000007423
Sequence length 546
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1528:214444:227274:-1 gene:ENSOPRG00000007419 transcript:ENSOPRT00000007423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLAELYVSDRESDATGDGSKEKPFKTGLKALLTVGKEPFPTIYVDSQKENERWDVISKS
QMKNIRKMWHREQMKNESREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPKCVKIHALE
GYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDELCQCYNGVVLSTESSVAV
YGMLNLTPKGKQAPGGHELSCDFWELVGLAPAGGADNLINEESDVDVQLNNRHMMIRGEN
MSKILKARSVVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQ
LYLETCIPAMGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEDLLNRLEDLVCDV
VDRVLKSPAASIVYDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGEDIPE
APERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSMRIWD
SEEMLAGYKREGIDPAPYYWYTDQXXXXXXXXGGYGLGLERFLTWILNRYHIRDVCLPRF
VQRCRP
Download sequence
Identical sequences ENSOPRP00000006799 ENSOPRP00000006799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]