SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006814 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006814
Domain Number 1 Region: 174-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.31e-105
Family Transglutaminase core 0.0000000155
Further Details:      
 
Domain Number 2 Region: 494-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.57e-26
Family Transglutaminase, two C-terminal domains 0.00033
Further Details:      
 
Domain Number 3 Region: 655-703
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000497
Family Transglutaminase, two C-terminal domains 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006814   Gene: ENSOPRG00000007433   Transcript: ENSOPRT00000007439
Sequence length 706
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5005:531414:655114:1 gene:ENSOPRG00000007433 transcript:ENSOPRT00000007439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQGWNFG
QFEEDILSICLTILDRSPSHQAYPATDVSRRYDPVYVTRVISAMVNSNNDRGVVQGQWQG
KYGGGTSPLHWSGSVAILQKWFKGRFKPVKYGQCWVFAGVMCTVLRCLGIATRIVSNFNS
AHDTDKNLSDKYVDSXXXXXXXXXXXXXXNFHVWNESWFARQDLGPSYNGWQVLDATPQE
ESEGVFQCGPASVTAIREGDVHLAHDSPFVFAEVNADYITWLWHEDESRERVYSDTKKIG
RCISTKAVGNDSRVDITGLYKYPEGSRKERQVYRKAVRTLFSTEARGRGGGGRRSGGRGL
WRDALLLEPPRQPSITGKFKLLEPPVLGHDLKLALCLANLTPQPQRVRVNISAATILYTR
RPVAEILQESHAVRLGPQEEKKIQIVITYSQYKEDLTEDKKILLAAMCLVTKGEKLLVEK
DVTLEDFITIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPSL
EPQEKASVQFSITPSKSGPRQLQVDLVSSHFPDVKGFVVIHVATAK
Download sequence
Identical sequences ENSOPRP00000006814 ENSOPRP00000006814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]