SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006851 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006851
Domain Number 1 Region: 197-355
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-58
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000288
Further Details:      
 
Domain Number 2 Region: 40-194
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.18e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000799
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000187
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006851   Gene: ENSOPRG00000007482   Transcript: ENSOPRT00000007481
Sequence length 355
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3240:126808:131961:-1 gene:ENSOPRG00000007482 transcript:ENSOPRT00000007481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACSPNPCLNNAACQSSVRGDVFTNYVCECPRGYVGTHCETRCAKPLGMEGGAITDSQVSA
SSVHVGFLGLQRWAPELARLHRTGIVNAWTASNYDRKPWIQVNLLRKMWVTGVVTQGASR
AGSAEYLKTFKVAYSLDGRKFRFLKKQMVFVGNVDGSGLKVNLFESPMEVQYVRLFPVAW
HRGCTLRFELLGCELNGCSEPLGLKDGSIPDKQITASSSYKTWNLRAFGWYPFYGRLDKQ
GKFNAWTAQGNDASEWLQVDLGAQKQVTGIITQGARDFGHVQYVAAYKVAHSNDGRNWTE
YRDPGAVDSKVFPGNLDNYAHKKNVFETPFRARYVRILPVAWHNRITLRLELLGC
Download sequence
Identical sequences ENSOPRP00000006851 ENSOPRP00000006851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]