SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006866 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006866
Domain Number 1 Region: 465-523
Classification Level Classification E-value
Superfamily UBA-like 3.23e-19
Family CUE domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006866   Gene: ENSOPRG00000007487   Transcript: ENSOPRT00000007500
Sequence length 754
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4737:152562:187652:-1 gene:ENSOPRG00000007487 transcript:ENSOPRT00000007500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALPLDQLQITHQDPKTGKLRTSPALHPEQKADRYFVLYKPPPKDNIPALVEEYLERAT
FVANDLDWLLALPHDKFWCQVIFDETLQKCLDSYLRYVPRKFDEWVAPSPEVADMEKHLH
RSVFLTFLRMSTHKESKEHFLSPAAFGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMI
GNIFTQQPSYYNDLDETIPTILQVFSNILQHCGLQGEGTSTTPQKLEERGRLTPSDMPLL
ELKDIVLYLCDTCTTLWAFLDIFPLACQTFQKHDFCYRLASFYEVAVPEMESAMKKRRLE
DSKLLGDLWQRLSHSRKKLMEIFHAILNQICLLPILESGSDNVQSFIEEFLQIFSSLLQE
KRFLRDYDALFPVAEDISLLQQASSVLDETRTAYILQAVESAWEGVERQKATGTRDSSVA
EDLNRESNGVTATTETISEKLPHPDNSEEEECLGATAAPAASVSGVELDSLISQVKDLLP
DLGEGFILACLEHYHYDSEEVINNILEQRLAPALSQLDRSLDRQVQPDPTPLLTSRHNVF
QNDEFDVFSRDSVDLSRVHKGRSARKEENVRSLINDKRAVAAQRQRYEQYSVVVEEVPLQ
PGDYHGDDYEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTRVPGEGQEEDDDD
EEEEVENEVPKPDHFVQDPAVLREKAEARRMAFLARKGYRHDSSATVTGNPRGHGQSRET
TQERRRKEANKATRANHNRRTMADRKRNKGMIPS
Download sequence
Identical sequences ENSOPRP00000006866 ENSOPRP00000006866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]