SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006900 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006900
Domain Number 1 Region: 420-543
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.16e-28
Family Ricin B-like 0.0064
Further Details:      
 
Domain Number 2 Region: 131-194
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000000000356
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.001
Further Details:      
 
Domain Number 3 Region: 295-381
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000534
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006900   Gene: ENSOPRG00000007531   Transcript: ENSOPRT00000007535
Sequence length 544
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_223:13015:51969:1 gene:ENSOPRG00000007531 transcript:ENSOPRT00000007535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVTVRYFCYGCLFTSATWTVLLFVYFNFSEVTQPLKNVPIKGSGPHGPFPKKFYPRFT
RGPSRVLDTQFKVNKIDDVIDNDIEDPEKGHLKFSSELGMIFNERDQELRDLGYQKHAFN
MLISNRLGYHRDVPDTRNAACRDKSYPADLPVASVVICFYNEAFSALLRTVHSVLDRTPA
HLLHEVILVDDDSDFGAGHSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMNIWRFEKRFRIWMC
GGRLFIIPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRPDLKTK
SYGNISERVELRKKLACHSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LYHFQTNRCLVAQGRPSQKGGLVVLKACDYGDPNQVWIYNEEHELVLNNLLCLDMSETRS
SDPPRLMKCHGSGGSQQWTFGKNNRLYQVSVGQCLRVMDPLGQKGSVAMAICDGSPSQQW
HLEG
Download sequence
Identical sequences ENSOPRP00000006900 ENSOPRP00000006900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]