SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007019 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007019
Domain Number 1 Region: 149-267
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000675
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 2-73
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000857
Family C-type lectin domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007019   Gene: ENSOPRG00000007668   Transcript: ENSOPRT00000007668
Sequence length 463
Comment pep:known_by_projection scaffold:pika:scaffold_124833:27:1486:-1 gene:ENSOPRG00000007668 transcript:ENSOPRT00000007668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWIGLQRQARQCQPQRPLRGFTITGDQDTAFTNWAQPAAPCPAQRCAALEASGDHRWLEG
SCTLAVDGYLCQFGFEGACPALPAEAGQAGPAVYTTPFHLVSTELEWLPFGSVAAVQCQA
GRGASLLCVKQPTGGVGWSQAGPLCPGTGCGPDNGGCEHECVEEEDGQVSCRCAEGFRLA
ADGHSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDEPHRCVDTDECQIAGVCQQM
CVNYVGGFECYCSEGHELEADGISCSPAGAMGARASQDLEEELLGIGGEDDEDEEEEAWE
DFDGAWTDGPGFLWLEPTQLPDFGLAYSPGFSEDQGPPRPHLEPTWPPPLSAPRVPSHTV
LSVTRPAVVSATRPTPPPSHQPPMNPATHPAVPRNHQIPGMTDSSPAQRPAPRPPVTAPE
PLISPVFPKKGIPDTRTTVHPPRNQRNPAPLFTTLGAYPHPLT
Download sequence
Identical sequences ENSOPRP00000007019 ENSOPRP00000007019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]