SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007059 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007059
Domain Number 1 Region: 29-132
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.96e-37
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000684
Further Details:      
 
Domain Number 2 Region: 275-418
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 6.28e-35
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00033
Further Details:      
 
Domain Number 3 Region: 610-788
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.57e-31
Family AlaX-like 0.08
Further Details:      
 
Domain Number 4 Region: 535-610
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000636
Family AlaX-M N-terminal domain-like 0.0068
Further Details:      
 
Domain Number 5 Region: 233-274
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.000000000154
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007059   Gene: ENSOPRG00000007693   Transcript: ENSOPRT00000007708
Sequence length 975
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4341:71278:82820:-1 gene:ENSOPRG00000007693 transcript:ENSOPRT00000007708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVAAAAVRLRPALGRSLSTAPPPASASAVRDAFLSFFRDRHGHRLVPSASVRPRGDP
SLLFVNAGMNQFKPIFLGTMDPRSEMAGFRRVANSQKCVRAGGRHSDLEDVGRDLSHHTF
FEMLGNWAFGGEYFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFMQHNR
EANGSLQPLPQRHVDTGMGLERLVAVLQGRHSTYDTDLFSPLLNAIHQGCGAPPYLGRVG
EADEGHTDTAYRVVADHIRTLSICIADGIFPGMSGAPLILRRILRRAVRFSTEILRAPPG
FLGSLVPVVVETLGDAYPELRKNSAQIAELVSEGEAAFLASLQRGRRVMEQTLKRLGPSD
TFPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGTCEAQVLQLYAEDGTAVASVG
EGQRCGLLLDRTNFYAEQGGQASDRGSLVKVGQQDVLFPVARAQVCGGFVLHEVMAPQCL
QVGDQVQLHVDKAWRLGCMEKHTATHLLSWALRQTLGPSTEQRGSHLNPERLRFDVATQA
PLTTEQLRAVEATVQEAVERNEAVHMEEVALARTACVPGLRSLDEVYPDPVRVVSVGVPV
AQALAPASQVALQTSVELCCGTHLLRTGAVGDLVIVGERQLTKGTTRLLAVTGEQAQQAR
EVGQSLAQEVEAATERLSRGSRGIAEAQRLSKDIGRLTDAVDTAVMPQWQRRQLQATLKG
LQRRANTAIRKLEKGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLVKVVRQLCEQAPST
SVLLLSPQPVGNVLCACQVAQGATPAFTAEAWALAVCSHMGGKAWGSQVVAQGTGSTANL
EAALDTARAYALNQL
Download sequence
Identical sequences ENSOPRP00000007059 ENSOPRP00000007059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]