SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007188 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007188
Domain Number 1 Region: 1028-1155
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000301
Family GAF domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007188   Gene: ENSOPRG00000007842   Transcript: ENSOPRT00000007850
Sequence length 1436
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3351:393547:541509:1 gene:ENSOPRG00000007842 transcript:ENSOPRT00000007850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESTSQEEPKPAQKNEKEDNERQQNSAEVKKPAESSQSVPDVSVTETSNNVGKEATDEI
KPQELTMEEQPTASTYSDPRTSGNIVIRKPAKVILDLDGSELKSKLEQPWKKNLFARVEA
RAQAMQQKILDKDNMKKELEKKTEKILPKDDLAKEWFNTESQTLNTRVYLLDKLLPTLVP
AAEQMLTQMEKKQFSTETDIVTKFDPINHLGEYLMRNNPLYIKDPGMSGYQRVMRDVTED
LKIHVPDTICNRVSKMKEQVKQKREKRERISLVKAKVANMRKEALQEQFNEWILDPKGMI
PLGVVQNVLHEFFQKPEVELXXXXXXXXXXXXXXXXXXXXXXXXYISSHIADFKSEMFEE
LLKHLCHCADEFREVIKADMRRQIFAELFLYCDRGKVGILDRERTLALLEMFYDQSPRML
RSLLRNPRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXSKATIPSVRIEIPLQEKRSWEQSYENYIPVRSEMQEQVPTS
SRKDPISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLHSIVRNIQSHKEVKGRSAFSAVSFNLLQFVQLLETFVGEDTSLNVSETLASFFK
RGYVERKEEKLSALEQVRQNAFRVRRGLLLEALFEKRHTDDSGFLNVKEVDELFHTYKQG
MEKESRKKAKLHIQFAKPHPGHEVRLSSKQFRNXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDAETHGNKKISAHIS
LLEENVLLPHRGSVVLRNVACTVDDAPFVLNKVLYRDMKGISFTVVDEGKPIHVPQVQHH
GNIFFWNQTRSKEDSNGSFLALPLQDAHMRIFGVLAVDTLRDPHKINIFLPHEIRFYQGV
ANVFSSAYHYIHSREHILHIVITGIGWLSNVTSGITSITTFFVEPSPNQXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIANVGEVRRAG
IIFFRTMLQELQDCLQLLSSMNFVSLLLYDHSTQVQPMSPQDSKARDLRANINLVQDILR
GIILFLHPELEFSSDLQNWDKCKFYVNKYLVKNICAFDPTASDLEINSELIGDYFK
Download sequence
Identical sequences ENSOPRP00000007188 ENSOPRP00000007188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]