SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007215 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007215
Domain Number 1 Region: 551-823
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-96
Family PDEase 0.000000000161
Further Details:      
 
Domain Number 2 Region: 141-327
Classification Level Classification E-value
Superfamily GAF domain-like 6.38e-25
Family GAF domain 0.0011
Further Details:      
 
Domain Number 3 Region: 439-526
Classification Level Classification E-value
Superfamily GAF domain-like 2.05e-19
Family GAF domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007215   Gene: ENSOPRG00000007849   Transcript: ENSOPRT00000007879
Sequence length 823
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2743:640026:876214:-1 gene:ENSOPRG00000007849 transcript:ENSOPRT00000007879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAGPSSGRPQQQQQQQHPRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFSERVHT
IPVCKEAVRGHPESCSCPSQPSPRADSSTPGTPTRKISASEFDRPLRPIVVKDSEGTVSF
LSDSDKKQQMPLTPPRFEHDEADQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADR
YSLFLVCEDSSNDKFLISRLFDVAEGSTLEEASNSCIRLEWNKGIVGHVAALGEPLNIKD
AYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVGVAQAINKKSGNGGTFTEKDEKDFA
AYLAFCGIVLHNAQLYETSLLENRRNQXXXXXXXLIFEEQQSLEVILKKIAATIISFMVQ
KCTIFIVDEDCSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXSESTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVKPFN
RNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAX
XXXPSAQTLKTDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNY
RKNVAYHNWRHAFNTAQCMFAALKAGKIQSKLTDLEILALLIAALSHDLDHRGVNNSYIQ
RTEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLA
LYIKRRGEFFELIRKNQFDVEDPRQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEF
DQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE
Download sequence
Identical sequences ENSOPRP00000007215 ENSOPRP00000007215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]