SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007312 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007312
Domain Number 1 Region: 969-1123
Classification Level Classification E-value
Superfamily FAS1 domain 1.12e-26
Family FAS1 domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1569-1718
Classification Level Classification E-value
Superfamily FAS1 domain 6.93e-24
Family FAS1 domain 0.0029
Further Details:      
 
Domain Number 3 Region: 515-651
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-23
Family FAS1 domain 0.002
Further Details:      
 
Domain Number 4 Region: 1131-1259
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-21
Family FAS1 domain 0.0035
Further Details:      
 
Domain Number 5 Region: 336-500
Classification Level Classification E-value
Superfamily FAS1 domain 1.02e-19
Family FAS1 domain 0.0024
Further Details:      
 
Domain Number 6 Region: 2281-2441
Classification Level Classification E-value
Superfamily FAS1 domain 2.75e-19
Family FAS1 domain 0.0095
Further Details:      
 
Domain Number 7 Region: 2232-2285
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000155
Family Link domain 0.00065
Further Details:      
 
Domain Number 8 Region: 1729-1874
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000000034
Family FAS1 domain 0.0039
Further Details:      
 
Domain Number 9 Region: 1463-1518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000272
Family EGF-type module 0.036
Further Details:      
 
Domain Number 10 Region: 1510-1548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family Merozoite surface protein 1 (MSP-1) 0.068
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000007312
Domain Number - Region: 1380-1506
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000144
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 1993-2120
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000596
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 2125-2158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000718
Family EGF-type module 0.063
Further Details:      
 
Domain Number - Region: 233-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00124
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 196-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00327
Family Merozoite surface protein 1 (MSP-1) 0.042
Further Details:      
 
Domain Number - Region: 876-910
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00695
Family EGF-like domain of nidogen-1 0.041
Further Details:      
 
Domain Number - Region: 905-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.036
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007312   Gene: ENSOPRG00000007900   Transcript: ENSOPRT00000007991
Sequence length 2544
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4380:155132:293695:1 gene:ENSOPRG00000007900 transcript:ENSOPRT00000007991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMLQHLVILSLGLVIQTFCSVTVLRGKGRRCDMPTFLLVKTECQSCVLSLNVKCPDGYDK
LTKAEGFRDCRYTFKVRQSSLLLPGCRHLCKKNYVEPRCCSGHWGPDCMECPGGWQSPCS
GRGTCAEGMNGSGTCSCQEGFGGTACETCANDSLYGPNCSQVCNCVHGVCSSGLHGNGTC
TCYSAYTGPSCDKPIECAALLCPENARCSPSSKDASKLECKCLPNYKSNGKDCEPINPCL
RNVCHPHARCTYLGPNQHNCTCQEGYYGDGQACLVLDPCQVNFGNCPKQSTVCRFDGPGQ
SYCECKEHYHKFVPGVGCSMINLCEINNPCHKNANCTTTAPGKTECTCQKGHVGDGMACY
GNIMERLRELNTEPRGKWQGSLTSFIALLDKVYAWPLSNLGPFTVLLPTDKGLKGFNIKA
LLLDKEAAEYFVKLHIIAGQMSTTRMNATDTFYTLTGKSGEIFIDDTGNQLKLYEAKNRV
KIIQGNIIASNGLLHILDRAMDELAPTLKSNTEQTIMEMLQPRYSKFRSLLEETSVGHAL
DEDRFGEAYTIFVPSNEALENMKDGTLDYLRSPEGARKLLELVRYHIVPFTQLKVATLIA
TPHIKSMANQIIQFNTTENGQILANGVAIEETEVSAKNGLIYTLSGVLIPPSIIPILPHR
CDETKREMTLXXXXXXXXXXXXXXXXXXXXXSLFKHRCVYSRMRVLKLGCARFCNATKKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXCLCVQGTCDNRIDSDGSCHAGTCRDSSAGRFCDKQTSVCGPYVHFCHIHATCEN
SNGTVSCVCAGYDGDGFICSEIDPXXXXXXXXXXXXAECMQTSSGTHSCVCQQGWTGNGR
DCVEINNCLLPGAGGCHSNATCLYVGPGQNACECKKGFRGSGINCEPIISCLEQTGTCHP
LATCQPTASGVWSCVCQEGYEGNGLLCYGNAAVELSSLSEAAAFNQWIYNASLQPMLSTT
LNLTLLVPSHQAIEDMDQVAKSFWLSQSNIPALIKYHTVLGTYGVEDLQTLSASDTLATS
LQDHFLRLEKVDGNITIEGASIVDGDNAATNGVIHIINKVLIPQRGLSSSLPNLLTRLEQ
MPDYTIFRGYLMRYNLVNTIEAASTYTVFAPNNNAIENYIREKRVTTLGEDIIQYHVVLD
EKLLKNDLHPGMHRETMLGFSYLLGFFFHNNQLYVNEAPINYTNVATDKGVIHGLGKVLE
IQKNRCDNNDTTIIRGKCGTCSQKPVCPLGTTPLGNETKRCIYTLYFMGKRSMFIGCQAK
CVKTVITRACCAGYFGPQCQACPGKGQNVCFGNGICLDGINGTGTCECGEGFGGTACESC
AEGKYGIHCDQACSCVHGRCNQDLSGDGSCECDVGWRGVRCDSAITKDSCNGTCHTSANC
LPNPDGTGSCKCAAGFRGNGTICTAIDACELSNGGCSAKAYCKRTTPGSRVCLCKAGYTG
DGIVCLEINPCLENNGGCDKNAECTQTGPNQAACNCLPTYTGDGKVCTLINICLIKNGGC
SEFAICNQTGKDKRTCTCKINYTGDGFTCRGNIYQELPRDPKTSQFFFQLQEHSMRELAG
PGPFTFAPSSAFNEDLRIRDWHQQGLMPQVLRYHMVACHQLPLESLKQTPNVTSLQGEPI
VVSISQGAVYLNKRAKVIASDFISTNGIIHIIDKLLSPQNLLVTPRDASGHILQNMTAVA
IKHGYIKFSNLLQDSGLLRVILDPIHTPVTVFWPTDKALQALPAEQQDFLFRQDNKDRLK
EYLSFHVIRDSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGELFLNGQMCRIVQRELL
FDLGVAYGIDCLLMDSTLGGRCDAFKTFTLSGGCGSCLSTPKCPSWSKPKVAKDKCEYQL
PQLKRTVQGCKHQCTLVIRLRRCCRGYFLPDCQACPGGPDTPCNNRGTCVDHYSPTRQCA
SNIGFNGTACELCLTGRFGPDCHPCNCSKHGQCDDGIGGSGQCLCEAGWTGRFCNTQTAF
PPVCTPPCSAHATCKENNTCECNLNYEGDGVTCTVVNFCDQNNGGCAKVARCSQKGTKVS
CSCQKGYQGDGRSCIAVDPCADGLNGGCHEHATCRMTGPGKHKCECKSHYVGDGVNCEPE
KLPLDRCLQDNGQCHADANCADLHFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXAKYHLCSAGWLESGRVAYPTAYASPNCGSGVVGIVDYGPRANKSEMWDV
FCYRMKDVNCTCKAGYVGDGFSCSGNLLQVLMSIPSLTNFLKDVLAYSNSSIRGQEFLKH
LTDLSFRGTLFVPENSGLGENETLSGRDIEHHLTNVNIFFYDDLVNGTILQTRLGSQLLI
TSSQDQSQLKETRFVDGRAIVQWDIFASNGIIHVLSRPLRAPSGPKTSTHTGFGTGIFLA
IILILGAVALGAYSYFRLNHRPIGFQHFKSEEDIDVGALSKQQPENISNPMYESTTSVLP
DPAYDPFVDSDEQPLESSDPLGAL
Download sequence
Identical sequences ENSOPRP00000007312 ENSOPRP00000007312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]