SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007349 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007349
Domain Number 1 Region: 19-170
Classification Level Classification E-value
Superfamily Globin-like 1.99e-42
Family Globins 0.000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007349   Gene: ENSOPRG00000008040   Transcript: ENSOPRT00000008030
Sequence length 190
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_634:186738:194175:-1 gene:ENSOPRG00000008040 transcript:ENSOPRT00000008030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVPGEMGDERRERGEELSEAERKAVQATWARLYANCEDVVVAILVRFFVNFPSAKQYF
SQFKHMEEPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVVAEEFANDFPAETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNTST
PPATLPSSGP
Download sequence
Identical sequences ENSOPRP00000007349 ENSOPRP00000007349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]