SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007409 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007409
Domain Number 1 Region: 115-436
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9.38e-57
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000036
Further Details:      
 
Domain Number 2 Region: 431-565
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.04e-31
Family Ricin B-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007409   Gene: ENSOPRG00000008094   Transcript: ENSOPRT00000008098
Sequence length 571
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2649:110135:329666:1 gene:ENSOPRG00000008094 transcript:ENSOPRT00000008098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRRSRMLLCFAFLWVLGIAYYMYSGGGSALAGGASGGAGRKEDWNEINTLKKKDLHHSN
GDEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPD
TRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSND
PEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLER
VAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAP
IKTPMIAGGLFVMDKLYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHV
FRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGXXXXXXXXXXX
XXXXXXXWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQ
EWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCL
DSRTAKNGGLSVEVCSPALSQQWKFSLNLQQ
Download sequence
Identical sequences ENSOPRP00000007409 ENSOPRP00000007409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]