SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007417 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007417
Domain Number 1 Region: 64-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000419
Family EGF-type module 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007417   Gene: ENSOPRG00000008119   Transcript: ENSOPRT00000008107
Sequence length 178
Comment pep:known_by_projection scaffold:pika:scaffold_655:109601:147781:-1 gene:ENSOPRG00000008119 transcript:ENSOPRT00000008107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLATPASGARSLPLLLALALGLVIFHCVVANGNSTRSPETNGLPCGYAGENCTATTVQP
KRKGHFARCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYTGARCERVDLFYLREDRRQIL
VICLIAVMVVFIILVIGVCTCCHPLRRNRKRRKKEEEIATLGKDITARNEDIEETNIT
Download sequence
Identical sequences ENSOPRP00000007417 ENSOPRP00000007417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]