SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007484 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007484
Domain Number 1 Region: 60-348
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.26e-111
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000424
Further Details:      
 
Domain Number 2 Region: 362-474
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.22e-26
Family Anticodon-binding domain of Class II aaRS 0.000000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007484   Gene: ENSOPRG00000008195   Transcript: ENSOPRT00000008181
Sequence length 478
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4354:346462:360476:-1 gene:ENSOPRG00000008195 transcript:ENSOPRT00000008181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRATARTCSAVCRCLLSGFGGRVEGTQPERVTGRASAHVELPGAGGPAAAPEHQEGSE
ALVDICRRRHFLSGTRLQLSPDCLLNGRHPGLGPWGVELRRNLAAEWWSSVVVFREQVFP
VDGRHGEPGPAPRGDGAFRLVSTETLRQILQDKELSKEELVACLENLLDTAGKLRESLLH
GALEHYVNYLDLVNKRLPFGLAQIGACFLPVSDTQQTPDGVKRIGEKTEASLVWFASPRT
SSQWLDFWLRQRLLWWRKFAVSPSNFSSSDCEDEEGRKGSKLYYSFPWGKEPIETLWNLG
EEELLHSFPGDAARLHGRDGRKNVVPCVVSVSGDLDRGVLAYLHDSFQLTENSFARKKHL
HRKVLKLHPCLAPIKVALDVGRGPTVELRQVCQGLFKELLESGISVWPGYLETVPSSLEQ
LYSKYDEMSILFTVLVTEGTLENGLVHLRSRDTTMKEMMHISKLKDFLIKYIASAQNV
Download sequence
Identical sequences ENSOPRP00000007484 ENSOPRP00000007484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]