SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007488 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007488
Domain Number 1 Region: 377-638
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-53
Family Nuclear receptor ligand-binding domain 0.0000000261
Further Details:      
 
Domain Number 2 Region: 305-382
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.42e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007488   Gene: ENSOPRG00000008197   Transcript: ENSOPRT00000008185
Sequence length 640
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1527:67990:102291:1 gene:ENSOPRG00000008197 transcript:ENSOPRT00000008185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THDSIRFNVDMPCVQAQYSPSPPGSSYAAQTYGSEYATEIMNPDYAKLTMELGGAEITAT
ATTSLPSFSTFMEGYSSSYDLKPSCLYQMQPSGPRPLIKMEEGRAHGYHHHHHHHHHHHH
HHQQQQQQPSLPPASGPEDEVLPSTSMYFKQSPPSTPTTPGFPPQTGAMWDDALPSAPGC
IAPGPLLDPPMKAVPTVAGARFPLFHFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPLG
ASAAAGSQTAALEGHPYGLPLAKRATSLPFPPLGITASPTASGLLGESPSLPSPPTRSSS
SGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQY
CRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPCPPSPPICMMNALVRAL
TDSTPRDLDYSRYCPTDQAAVGTDVEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQ
TLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQS
LNLDIQALACLSALSMITERHGLKEPKRVEELCNKIRSSLKEHQSKGQALEPTESKVCGA
LSELKKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
Download sequence
Identical sequences ENSOPRP00000007488 ENSOPRP00000007488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]