SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007490 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007490
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-36
Family Eukaryotic proteases 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007490   Gene: ENSOPRG00000008185   Transcript: ENSOPRT00000008187
Sequence length 247
Comment pep:novel genescaffold:pika:GeneScaffold_4893:28559:29881:-1 gene:ENSOPRG00000008185 transcript:ENSOPRT00000008187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGQPQLWDIRAQIVGDQAALDDRWPRQASLRLHGVHMGSLLSPQWVLTVVHCFSGSNSSD
QILSHTSTVVLYSNPGLPGASRDIALVQLTGPATLSSQVLPVCLLAASTDISPGTWCCVG
EPLVPLNILQEAPVSTVEAQTCRDYPSQDGSVFQLDMLCAGGPGGTCQFGGSLACQTGVV
SWGKGCGHPDGPGVCTRVTYVDWIHHGPELGGLGPGLLLQAGLSLSGLPLLLAKHWLQSA
LLPAPVS
Download sequence
Identical sequences ENSOPRP00000007490 ENSOPRP00000007490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]