SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007500 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007500
Domain Number 1 Region: 204-375
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-33
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0055
Further Details:      
 
Domain Number 2 Region: 334-459
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.04e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007500   Gene: ENSOPRG00000008202   Transcript: ENSOPRT00000008199
Sequence length 459
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4574:17105:27097:1 gene:ENSOPRG00000008202 transcript:ENSOPRT00000008199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCFSKPKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKISK
SLDVQPEQLALRSKEFFRAYGIEVLTEAQVVTVDAKNKKVVFKDGFKLEYSKLLLAPGSS
PKTLSCKGKEVENVFTIRTPEDANRVGRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSM
VELEETPFRKFLGERVGRALMKMFENNRVKFYMQTEVMELRAQEGKLKEVVLKSSKVVRA
DICVVGIGAVPATGFLRQSGVGLDSKGFIPVNKMMQTNI
Download sequence
Identical sequences ENSOPRP00000007500 ENSOPRP00000007500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]