SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007595 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007595
Domain Number 1 Region: 5-133
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.27e-31
Family Hormone receptor domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000007595
Domain Number - Region: 125-409
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000146
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007595   Gene: ENSOPRG00000008298   Transcript: ENSOPRT00000008300
Sequence length 455
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1772:85915:91374:1 gene:ENSOPRG00000008298 transcript:ENSOPRT00000008300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLLLLLALWAPETGAVRLTAGELYRRWERYRRECQESLEAAEPPSGLACNGSFDMYVCWD
YAAPNATARASCPWYLPWHRQVAAGFVLRQCGSDGQWGPWRDHTQCENPEKSGAFQDQRL
SLERLQVMYTVGYSLSLATLLLALLILGSFRRLHCTRNYIHINLFTSFMLRAAAILTRDR
LLPPPSPHSGNQAPALGSQALAACRTAQIVTQYCVGANYTWLLVEGVYLHSLLVLVGGSE
EGHFRGYLILGWGAPALFVIPWVVVRYLYEDTQCWERNDVKAIWWIIRTPILITILINFL
IFIRILGILVSKLRTRQMRCPDYRLRLARSTLTLVPLLGIHEVVFAPVMEEQARGALRLA
KLGFEIFLSSFQGFLVSILYCFINKEVQSEIRRSWRHRRLHRSLGDEQRQLPDCRTTRAL
PLGSGLGEVRTSRAMSCGTLPGAGDDGSRVLESYC
Download sequence
Identical sequences ENSOPRP00000007595 ENSOPRP00000007595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]