SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007735 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007735
Domain Number 1 Region: 269-314
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000021
Family RING finger domain, C3HC4 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000007735
Domain Number - Region: 155-243
Classification Level Classification E-value
Superfamily Respiratory nitrate reductase 1 gamma chain 0.0981
Family Respiratory nitrate reductase 1 gamma chain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007735   Gene: ENSOPRG00000008450   Transcript: ENSOPRT00000008448
Sequence length 323
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3247:6535:8668:-1 gene:ENSOPRG00000008450 transcript:ENSOPRT00000008448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAAFGEVIRAAQKDELYRGLRPAAGGALHSLAWARRWMEWRREVELLADVAYFGLTTV
AGYQTLGEEYVGIVPVDPSRRQVPSRWRRVALVLLHTVLPYLLEKALLPLEQALQAEAEG
LRAPQGSPGLGGRSRAGLWPWVRRRVAALPEPQRRGLQRAAFILRQGLACLQRLHLAWFY
IHGVFYHLAKRFTGITYQLHARRLHGEDLRTRTSYRLLGLLSLLHLALSVGLQLHGFRQR
QHARKEWRLHRHLSHRSSAEDRVTSRSPLCTLCLEERRHATATPCGHLFCWECITEWCDT
KTECPLCREKFPPQKLVYLRHYR
Download sequence
Identical sequences ENSOPRP00000007735 ENSOPRP00000007735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]