SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007802 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007802
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5e-16
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 175-241
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000101
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 230-296
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 111-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 292-357
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 506-551
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000361
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007802   Gene: ENSOPRG00000008521   Transcript: ENSOPRT00000008524
Sequence length 590
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1451:248487:280349:-1 gene:ENSOPRG00000008521 transcript:ENSOPRT00000008524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RECGTLDVPEHALMNCSHPLQTFSLHSQCSFRCTEGYHLSGPSTLQCLASGLWDNELPQC
VATQCPSPKIQENMICLHSAKAQHQSSNLTCAEEFITGPQEVRIALVCGVVQCQPLETPN
KATMDCAHPLADFAYGSSCKFECQSGYRVRGLDTLYCTGSGQWTAPLPTCEATTCKPLES
PAHGIMDCSPSERAFLYNTKCSFHCAEGFVLQGADAVQCTDSGEWTAPAPICQALQCQDL
PLPKKAQLNCSNPFGAFRYQSVCSFSCDEGSLLVGASVLECLDTGHWSASPPECQAITCT
PLLSPQNGILTCVQPRGDASYKSTCQFSCDEGFSLSGPERLDCTPSGQWTGSAPTCKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXMNCSTPWGFSFRSTCTFHCPKGQLLNGSARAECQQNG
QWSAPTPTCQAGSLTVQEALTYIGGGVASLAGLATAGTLLALLRKRFRQK
Download sequence
Identical sequences ENSOPRP00000007802 ENSOPRP00000007802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]