SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007850 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007850
Domain Number 1 Region: 603-651,792-1020
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.58e-56
Family Protein kinases, catalytic subunit 0.00067
Further Details:      
 
Domain Number 2 Region: 17-144
Classification Level Classification E-value
Superfamily UBC-like 1.24e-35
Family RWD domain 0.00000128
Further Details:      
 
Domain Number 3 Region: 340-546
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-33
Family Protein kinases, catalytic subunit 0.00084
Further Details:      
 
Domain Number 4 Region: 1060-1309
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.07e-27
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007850   Gene: ENSOPRG00000008540   Transcript: ENSOPRT00000008578
Sequence length 1648
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1869:171:117199:1 gene:ENSOPRG00000008540 transcript:ENSOPRT00000008578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGRGAPGRGRDELSESYPQRQDHELQALEAIYGADFQDLRPNACRPVNEPPEINLVLY
PQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNARGLSNESVNLLKSRLEELAKKHCGE
VMIFELAYHVQSFLSEHNKPPPKSFHEEMLERQAQEEQQRLLEAKRKEEEEKREILHEIQ
RRKEEIKEEKKRKEMAKQERLEIVSLSSQNHTSRKDPGGHRTAALLHGGSPDFVGNGKHR
TSSSVRSRRERQYSVCSSEDSPGSCEILHFSVGGPDQLMVHRGKCVXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQGAETEFSSLVKLSHPNVVR
YFAMNHREQDDSIVVDILVEHISGVSLATHMSHTGPIPVHQLRRYAAQLLSGLDYLHSNS
VVHKVLSASNVLVDAEGTIKITDYSISKRLADICKEDVFEQTRVRFSDNALPYKTGKKGD
VWRLGLLLLSLSQGQECGEYPVTIPGDLPADFQFLKKCVCLDDKERWTTPQLLKHSFLNP
QPKAPLMEQSPEDSGQDYVETVIPSQPSAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXVQNKLDGCCYAVKRIPINPASKHFRRIKGEVTLLSRLHHENIVRYYNAWIERHERPTG
PGTPPGDSGPLARDTRAAHGQAAGDTDSPDSVEANAPPPILTSSVEWSTSVERSASSRFP
ATGPGSSSDEEDDEDEEDEHDGVFSQSFLPASDSESDIIFDNEDENSKNQNQDEDCKEKN
GGRESELSVTTEAVHYLYIQMEYCEKSTLRDTIDQGLFQDTTRLWRLFREILDGLAYIHE
KGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFAADGKQDDHSDHLIKSDPSGHLTGM
VGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLSQLRDPTSPK
FPEDFDDGEHAKQKSVISWLLNHDPAKRPTAMELLKSELLPPPQMEESELHEVLHHTLAN
VDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKIQQHVCETIIRIFKRHGAV
QLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPYDLRVPFARYVARNNILNLKRYCIER
VFRPRKLDRFHPKELLECAFDIVTSTTNSSLPTAEIIYTIYEIIQEFPALQERNYNIYLN
HTMLLKAILLHCGIPEDKLSQVYVILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKFI
EQKGDLQDLTPTVNSLIKQKTGVSQLVKYSLKDLEEVVGLLKKLGVKLQXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXATTSSCDLLVVSVGQMSMSRAINLTQKLWAAGIAAEIMYDWSQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVKSFEKERQTEKRVLESDLVDHVVQKLRTKISDERSIR
EVSDNLAVQNLKGSFSNASGLFEIHGATVVPIVSVIAPEKLSASTRRRYETQVQTRLQTS
LANLHHKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVCD
EIYNIKVEKKVSVLFLYSYRDDYYRILF
Download sequence
Identical sequences ENSOPRP00000007850 ENSOPRP00000007850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]