SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007948 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007948
Domain Number 1 Region: 74-165
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.17e-25
Family Cold shock DNA-binding domain-like 0.00000586
Further Details:      
 
Domain Number 2 Region: 25-74
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000628
Family ECR1 N-terminal domain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007948   Gene: ENSOPRG00000008688   Transcript: ENSOPRT00000008683
Sequence length 293
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1955:109242:116012:1 gene:ENSOPRG00000008688 transcript:ENSOPRT00000008683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEMRLPVARKPLSESLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLVASVAGAV
ERVNKLICVKALKTRYNGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGEL
RRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXIKDILKPEITEEIVMETRQRLLEQEG
Download sequence
Identical sequences ENSOPRP00000007948 ENSOPRP00000007948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]